DPCstruct | MC11128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 74.40 |
| Pfam Score | 93.45 |
| Assigned Pfam label(s) | PF00284- PF00283 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2FTD8 | 1-81 | MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE |
| A0A5C7GQ22 | 56-136 | SGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRS |
| A0A5A7RBU0 | 1-85 | None |
| A0A7J8YBW5 | 34-114 | None |
| H6T0E0 | 1-74 | None |
| A0A3S3PBQ4 | 10-85 | None |
| A0A7J6F276 | 25-102 | None |
| A0A2D0H9V8 | 1-70 | None |
| A0A445D768 | 31-108 | None |
| A0A077RU33 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.