DPCstruct | MC11127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 103 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.85 |
| Pfam Score | 86.12 |
| Assigned Pfam label(s) | PF02788- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287RJI4 | 107-227 | LFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECL… |
| A0A5C7GN59 | 1-93 | MFTSIVGNVFWFKALRALRLEDLRTPPAYSKTFQGPPHGIQVEREKWNKYGRPLLGCTIQPKLGLSAKNYGRAVYECLRGGLDFTKD… |
| A0A2G2WNQ3 | 27-159 | None |
| A0A5N6PUJ2 | 2-110 | None |
| A0A2G3D3C7 | 6-111 | None |
| A0A2G3CNH5 | 3-107 | None |
| A0A2G3CMJ7 | 2-74 | None |
| Q0YUK4 | 96-204 | None |
| A0A446Q0P2 | 44-116 | None |
| K1YYQ0 | 93-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.