DPCstruct | MC11125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 216 ± 25 aa |
| Standard deviation of domain lengths | 25.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6D4U6 | 1-243 | MESAVAAQIACELSREVNVVYNESKKHPEGRQNYDFFFGWLAQLQLTFYVDEQTTINPTASFISKLHPLAAGDTFTLGLNASHKNEA… |
| A0A2U8Q697 | 106-308 | SKQLASRIKAAREFEKKLKATKKAPSNDEERNLLELARLSKVGVAYSFDFNITEVNKAGADAGFRLPGLTSVLDVGATGALDLTRNG… |
| A0A177J483 | 24-220 | None |
| A0A1H7BSD6 | 54-282 | None |
| A0A163TKI4 | 15-211 | None |
| A0A2A2VE58 | 76-255 | None |
| A0A1I2JCP7 | 48-264 | None |
| A0A1Q9B0D7 | 34-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.