DPCstruct | MC11124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 3 aa |
| Standard deviation of domain lengths | 2.76 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8W0P1 | 268-353 | QKLEARPGRNRVTEACRQAVASEAYRDGARQVEVASAGPERRTPGGGLAAAVRVRITYDRFLGSAVREATLTCVLDRAGRIVEARV |
| X6CXQ2 | 1-81 | MPGVPDEVIRACHDAIESAAAPFGATRVRVSSAGLVRQLSRDTISAPVEVSIDYVRQGSVETRQAPIKCELNATGSVIGLT |
| A0A562PFQ9 | 170-258 | None |
| B8IM76 | 307-394 | None |
| A0A086MNB4 | 22-111 | None |
| A0A512BMU2 | 1-91 | None |
| A0A440EHZ0 | 32-119 | None |
| A0A2T1HW92 | 153-237 | None |
| A0A5B2V6S0 | 266-350 | None |
| A0A0H1RGI9 | 164-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.