DPCstruct | MC11123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0123- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0DV23 | 54-187 | PAYITVAQFEANEARLAASRARAEAMGAVRGGPALTAGLVHCGRCNRRMSVRYHTQHSKALPEYVCARDVTNYGAQKSCQLLNSACV… |
| X6CNU8 | 1-109 | MENQRRLANNINRYEAGHSGVPRKGAALLQGIAVCGRCGRRMSLRYSGPAGDYPVYTCRADRDQEGGPLCQEVRALPVDAHVESILL… |
| X6CL20 | 121-228 | None |
| A0A143PIZ1 | 196-326 | None |
| A0A6L7ZUU7 | 320-466 | None |
| A0A7W8XL15 | 1-113 | None |
| A0A560HJ01 | 36-171 | None |
| A0A3N5S8S2 | 77-177 | None |
| A0A4R0X8E3 | 115-197 | None |
| I9C6L0 | 63-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.