DPCstruct | MC1112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00857 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6K2Q4 | 122-207 | NCDLSSIIHAAHVGFAVEFLSDATGSLPYANGAGYASAEEIHRVVSIILQSRFAAVLETAEWIDCLKTGALPERDTPYASNQRALA |
| A0A2V3U3Y9 | 398-482 | CVLSTIVHALHMGFSVEFLSDAAGSIPYANSAGYASAEEIHRVVRIVLQSRFAAVLHTADWIERLKAGVLPERDTIYASYQRALA |
| A0A3S0AUI2 | 4-95 | None |
| A0A358IQR8 | 21-108 | None |
| A0A1H4B070 | 121-201 | None |
| F5YSR7 | 89-161 | None |
| A0A7I7JSX2 | 48-120 | None |
| A0A4Q8LLE5 | 121-207 | None |
| A0A7X8VKZ9 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.