DPCstruct | MC11112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 211 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318TAE2 | 8-229 | DAIIQNTAGHSGGYPAGVPKMYTWYRGATKHRTGGGPPPHFTAVTGWGSIYREARSADQPETDQSVDLANAKTYVHIKDTKEWRQVQ… |
| A0A3B8NYF4 | 110-341 | NEQHSFMDCNSQTGAEWERGRVNASVLFPPTSAHKSVLAIGAMFKNPQLPLEDDQEFTVCFGRMTLCLRTKTSDGWFLANDIPYPPE… |
| A0A7X7HNQ1 | 135-379 | None |
| A0A564ZI43 | 104-318 | None |
| A0A7V3EMP9 | 380-606 | None |
| A0A1F7UJC1 | 127-287 | None |
| A0A139P5G3 | 59-267 | None |
| A0A3C0BB94 | 28-226 | None |
| A0A0R3UNS5 | 1-178 | None |
| A0A2U0TJV7 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.