DPCstruct | MC11110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3618 |
|---|---|
| Mean domain length (aa) | 136 ± 24 aa |
| Standard deviation of domain lengths | 23.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.52 |
| Pfam Score | 87.07 |
| Assigned Pfam label(s) | CL0023- CL0436- CL0123- PF14811- PF03477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8F319 | 1-101 | MEAHLQVLLAEHVQLLGEGYTLVRREYMTAIGPVDLLCRDESGGAVAVEIKRRGEIDGVEQLTRYLELLNRDSVLAPVKGVFAAQQI… |
| A0A842N9K1 | 43-163 | EKKDSFSIYNLGERFEQVVEEIFQAKGYKTSRRQRLKGESGTINEIDVLAEKGASTIAVECKNLSSPVGQSLIRDFIQKLYELKIRK… |
| A0A1F2P3M3 | 18-132 | None |
| A0A4R0JX75 | 11-145 | None |
| A0A5S6QI24 | 27-179 | None |
| A0A7D5YEX3 | 4-95 | None |
| A0A7I6V7K6 | 31-183 | None |
| A0A847PH90 | 766-902 | None |
| A0A2A7DAX3 | 19-156 | None |
| A0A6S7GYF5 | 960-1123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.