DPCstruct | MC1111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 17 aa |
| Standard deviation of domain lengths | 17.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF14789- CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8RB60 | 446-681 | SLFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGNQALTFTSQQAYQLADALKGIDAAQSALLSRLAESQKPLV… |
| S5STQ6 | 1-206 | MTSSAYARGLATLTYDGTVLDVWYPAPKLDEPVTAAGTERLETTPQQFAALAGPDETRGVARVPVATRISDLGQAPVDAYDVYLRLH… |
| A0A433BG06 | 29-276 | None |
| A0A160NWL1 | 235-445 | None |
| A0A1I3VKF5 | 1-188 | None |
| A0A3S5JIC8 | 129-354 | None |
| A0A087BMY2 | 125-333 | None |
| A0A2E8XIW9 | 4-244 | None |
| A0A5Q2VY24 | 38-262 | None |
| A0A4R3Q4S5 | 1-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.