DPCstruct | MC11108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1RG69 | 70-163 | GGSIRAFAEKGVKARQIGLLQLVNRLLDPEWKVGKGRVDVAVFIGTEYAIANNVFSTLKNWGDVKTLSISPYFQPNATVSFGNTSEE… |
| A0A842MNP8 | 2-77 | DTEWEGLDGNGAYDFVLLIGLPYHMGLEVMSALKHFASHITTVNLDNMYNPQANWSLPNLSVEEWVNTLMSIVSQL |
| A0A7C2WMY0 | 17-86 | None |
| A0A7J4FVX8 | 79-165 | None |
| X1BYC2 | 18-108 | None |
| A0A832WQP9 | 1-65 | None |
| A0A2M7JZS3 | 30-116 | None |
| H1L0V4 | 77-140 | None |
| A0A133UCH0 | 24-119 | None |
| A0A1V5XUZ7 | 4-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.