DPCstruct | MC11105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 213 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8TNT1 | 5-209 | ATLGEIARWLQKGFRVPLGYFKLAEVGSWGALREDAASAWVGLMARLRELGGTIDGPYGDTKRPLMKTISTGASKTSFHICGRAVDL… |
| A0A7C6VY89 | 98-296 | LGRFTFKDIAGGKLREDVADEWTKLVTRVKGLGGTIDQPYGDTKRHPGRTSKSGASSFSFHMAGRAVDISQALGGPPNQRYYIAKES… |
| A0A800D602 | 226-450 | None |
| A0A838GSX9 | 41-251 | None |
| A0A6J4RNY5 | 924-1098 | None |
| A0A7V5TNK5 | 18-229 | None |
| A0A359EFB3 | 90-311 | None |
| A0A7L4ZNG7 | 109-319 | None |
| A0A4Q5XBK1 | 27-243 | None |
| A0A7V2PQ21 | 314-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.