DPCstruct | MC11104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843PC36 | 2-120 | LGIVLATHGQLSTGFKDAAEVIMGSVENIAVVNLNHGEDIQLLGNKIREAIHETDQGDGVVVFADLLSASPYNQSVVTINQLEEPLQ… |
| A0A2V8TLH4 | 1-129 | MVSVLVITHGNLAEELVKAARRIVGEVGRLSALTIGWDEDVSTARRKVEEAILALDDGDGVALLTDMFGGTPTNISLSFLRKGKVEI… |
| A0A6L6YG37 | 2-118 | None |
| A0A1Q4XHS3 | 2-146 | None |
| A0A0R1UE04 | 1-122 | None |
| A0A378A5B9 | 215-344 | None |
| A0A447U7V7 | 26-181 | None |
| A0A377D5F8 | 1-78 | None |
| H3NMD7 | 7-143 | None |
| A0A7H4MMW3 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.