DPCstruct | MC11102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M8S8J8 | 253-336 | PESRPAYAGQNISSPPQPALQVILKDGQQLQVHNYLLTSTALTVLDNSYRQIPIDQIDINATRQTNLANGLDFRVPRAAPANGK |
| A0A2V8ZVJ2 | 1-69 | MKVEPPVTLLQLRDGSMYSLIRYWVHGGRLHYVTDYGGEENVPPERIDVAKTTQPNASRGTPLILLEKS |
| Q02CP6 | 99-177 | None |
| A0A7C4VZJ5 | 12-93 | None |
| A0A386C5Y0 | 1-118 | None |
| A0A7X7YFV8 | 2-83 | None |
| A0A2V9XXB0 | 161-248 | None |
| Q01XG7 | 24-121 | None |
| A0A2V9C245 | 120-208 | None |
| A0A2U3K9A0 | 199-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.