DPCstruct | MC11101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 213 ± 32 aa |
| Standard deviation of domain lengths | 32.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523AU62 | 71-301 | TVELRLIGIRTPLIRPGDHLPSLLLKALRRAGGVREGDILVLSSKVVAVSQGRMVRLSEVRPSPRALRLSRKTGLDPSFVEVVLREA… |
| A0A2V8TBV2 | 20-219 | ALIAKALRDASIEVVEQDVFVVAQKIVSKAEGRIVHLDSVVPSLRALEWAAAFDKDPRVVEVVLHESKRLVRMERGVLISETEHGFV… |
| A0A7X6NF83 | 2-232 | None |
| A0A5B8MP51 | 199-418 | None |
| A0A1R4K8V0 | 180-428 | None |
| A0A1H3S6W2 | 6-234 | None |
| A0A516X153 | 301-518 | None |
| A0A7X9GV64 | 156-423 | None |
| A0A2H9N7G5 | 209-423 | None |
| A0A2M7FLZ3 | 104-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.