DPCstruct | MC11100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5T7L8 | 150-283 | IKEKKEKEPRKTPVSISRGTFTVDGVIGKAALNYDIADLKYLYFYVPGEGTVVVSNAPFAGAQEQKGAFNDASLKVNADGHEMELAS… |
| A0A4Q1SJS3 | 234-356 | MPAFNGEVAMDPGLDDLRIVSPMIVEGGRVLADWEGNSGFAKAANAEAMLYSPGTGRFRFYTSPHPNTTEGTVDKNRVKFEIDGKKY… |
| A0A397NKG1 | 1-154 | None |
| A0A2V9LH81 | 109-246 | None |
| I3ZGJ5 | 2-125 | None |
| A0A239LP98 | 27-196 | None |
| A0A355DYF9 | 161-277 | None |
| A0A2V8VAW9 | 19-170 | None |
| A0A239H0N6 | 38-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.