DPCstruct | MC1110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF11172- PF00691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0VJF5 | 2-173 | QTVDNDIKRIVVQIESIDASLDELTKPGQSDLKRAFDLFSDNASKIKNMEKDFAKHADLMETSGEEYFAAWDSDKESYDNPEIQKQS… |
| I0ICF8 | 37-222 | APEIANASQALTSLRVLREDLANGQGRLFTMAETLREATAPQDLALGPWFNRYRSQREGVRDLAMSLREGYANLQNAERVYISTWEQ… |
| A0A1G1GUP5 | 11-214 | None |
| A0A432RQ41 | 7-193 | None |
| A0A7C4EF53 | 7-207 | None |
| A0A2E0HF81 | 28-212 | None |
| A0A351WPY1 | 21-231 | None |
| A0A812IN04 | 381-569 | None |
| A0A812XVR6 | 209-406 | None |
| A0A812IP41 | 397-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.