DPCstruct | MC111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813GKZ3 | 188-310 | DGGAKDLAKEPALENSRQRRPADTAPSSSLLPETSSPSTEVPRREGREAALHEWLEGLDAGKGGLLQYFDVIRAEFDSDLRQLRAVR… |
| A0A813EPG5 | 5-152 | ASGASSRAPAARISNSRSRSRHRKRRRHRREQSAERTPTPPNKGVWENNPAPVPTQAPEPEAPEASQVHGEELDELRDWLLSLDSGR… |
| A0A813GJ52 | 1-130 | None |
| A0A812T055 | 471-623 | None |
| A0A2D5MA29 | 48-193 | None |
| A0A812IDN3 | 103-232 | None |
| A0A812QIF9 | 629-797 | None |
| A0A813KQ29 | 22-155 | None |
| A0A813JPD1 | 123-288 | None |
| A0A813LNX2 | 507-658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.