DPCstruct | MC11098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 244 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1GI33 | 4-226 | LVSFYKYNTSEKHYINVKVKAGQGLWWYSGNNPKIWMLNSLNKDILNNPQIALKSIRYYPINPESNNNTDSFDIFIIARISVIKDGN… |
| A0A518SBQ7 | 211-467 | AGDTQPQFANQSITLGANVPLTTTEYSVTGQVTQLGTTGLNLTTTDVVMETTVATTTAQALSAGDTYRIHNTTVAEVTSIQVYPTGN… |
| A0A4D6HEP4 | 105-356 | None |
| Q9HST9 | 37-257 | None |
| A0A2V2FYW7 | 1-283 | None |
| A0A496Y5U6 | 177-411 | None |
| A0A2E7NEJ7 | 93-351 | None |
| A0A2R6GQ61 | 353-567 | None |
| A0A1G6W1S7 | 201-468 | None |
| A0A381P1J0 | 103-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.