DPCstruct | MC11097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 250 ± 79 aa |
| Standard deviation of domain lengths | 78.66 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 97.64 |
| Assigned Pfam label(s) | CL0023- PF04949- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1FM20 | 68-290 | ALAVIADISRRGKLPLVVGGTGLYIKSLLTDMPDMEILPDADLRQQLSGKNSNELGEILRARDFVKWQKMNVSDRQNPRRLVRAIEV… |
| A0A2X3M7N6 | 2-164 | ADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISG… |
| I3SF76 | 12-221 | None |
| A0A670IU23 | 44-380 | None |
| A9SYC6 | 148-444 | None |
| A0A1S6XQJ9 | 8-164 | None |
| A0A287I698 | 28-202 | None |
| A0A7J9E9J8 | 10-191 | None |
| T1FFQ0 | 25-419 | None |
| A0A7X7G6C6 | 35-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.