DPCstruct | MC11094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9AUH7 | 1-117 | MINQNVEQIRDNRRPPRHYRGHRPNRSGYWNGHRGYRHYRRGYRRHNDGWWYPLAAFGAGAIIGGAISQPRPIYRAPRMSNAHVRWC… |
| A0A0Q6T4N2 | 62-151 | YRDGSRYYYNGHRGYNYYRPGYREYNGYWFPLAAFATGAIIGGAIAQPRPVPSYGNSHVQWCANRYRSYRAYDDTFQPNYGPRRRCV… |
| A0A1W2D4L4 | 38-152 | None |
| J2L1S9 | 25-123 | None |
| A0A441UMM0 | 198-288 | None |
| A0A1V2SBF8 | 2-89 | None |
| A0A3S1NM76 | 1-114 | None |
| A0A2G9X2F1 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.