DPCstruct | MC11093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 259 ± 31 aa |
| Standard deviation of domain lengths | 30.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11957 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6QK04 | 5-202 | NNTLTEEQVKFVKESEEKCYRLLRETHPRGAHFAESVKHILQRELEWARWKSESCPAMTDLADKHPMQPYKKRPRTSFNPDVIDLGS… |
| A0A2P2M6I7 | 29-283 | GKNDKDLTSESMKQEIKSCEEQVKRILERTPPKGRDFLQKIEHVLEREKNWVWWKRDGCPPFEKQPVEKKIVQDGRKKRKPRWRLGN… |
| A0A2A4JXE8 | 276-543 | None |
| A4RSD1 | 269-521 | None |
| A0A7S4CF65 | 269-564 | None |
| G1Q608 | 313-564 | None |
| R9AVJ0 | 267-561 | None |
| A0A158PJ03 | 169-408 | None |
| A0A6A3AZZ3 | 32-290 | None |
| A0A669BIR8 | 212-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.