DPCstruct | MC11092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6SXW8 | 102-343 | YSDSEDGDNVKDSIMQDGLDRQNDDMNLDIKKQKKKLKKLLDKDPEFANFLEKWQSELESYRSKEASDEEDGMDSMDDDDDSNDGNS… |
| A0A2P2M6B5 | 10-214 | EEDPEFYHFLQEHDRELLEFDDEDIEEEADTEVDVEMQVDEKIRHHKISEKEEKPSQNVITTEMVESWCTSVQENGTIGAIRSLLRA… |
| A0A7S2S7C6 | 142-373 | None |
| A0A438G868 | 124-329 | None |
| A0A3P6CCQ4 | 11-196 | None |
| A0A7S3GAP6 | 19-255 | None |
| M4DE19 | 8-203 | None |
| A0A7R9ABJ5 | 186-468 | None |
| A0A7T8KD38 | 1-219 | None |
| A0A0L6VQ70 | 122-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.