DPCstruct | MC11091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 198 ± 25 aa |
| Standard deviation of domain lengths | 24.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T3Q8 | 97-295 | SKNVLTSYRNATAGDSAIISDPIVTNALMYISRVLNDSVNALTGEDERRQISSLICHFIRKVDFGRDFEQQLAFYVEARSVLSNLDS… |
| A0A2P2LXS9 | 1-205 | MLIMWNIEELFAVWYISSNYMFGRNGYLRDPTIIQLLFEITQSLHYGLDFANMKDDDNQQATRLISRFIQMVDYGGAVEQHLTFLVE… |
| A0A2K3NMC5 | 151-347 | None |
| A0A132AEI8 | 3-180 | None |
| A0A7R9DLX2 | 201-429 | None |
| A0A2Z6MAZ7 | 52-199 | None |
| W4GJZ4 | 4-248 | None |
| T1HBB7 | 94-314 | None |
| A0A1I7Z9S5 | 190-371 | None |
| A0A6N2MJI3 | 146-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.