DPCstruct | MC1109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Standard deviation of domain lengths | 4.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9BI48 | 70-126 | TIRKNKWGINFESVACPCCTTRLPQIRKPKSVQQALWGGYTCPTCGVEVDKWGRKIN |
| A0A2N0VEM1 | 2-59 | KILKEKKWGINFETVNCPQCDERMSKTRTPDNLRQLLWGGWKCPVCGCEMDKWGKPID |
| A0A0F9RY52 | 9-59 | None |
| A0A2N3CHD3 | 78-132 | None |
| A0A354GX38 | 27-89 | None |
| A0A518A846 | 27-73 | None |
| A0A5B9VU88 | 3-49 | None |
| A0A3F3I9C8 | 4-58 | None |
| A0A833D567 | 22-68 | None |
| A0A6N4QW27 | 2-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.