DPCstruct | MC11089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 233 |
|---|---|
| Mean domain length (aa) | 209 ± 39 aa |
| Standard deviation of domain lengths | 39.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.89 |
| Pfam Score | 85.31 |
| Assigned Pfam label(s) | PF00408- CL0754- PF08336- CL0448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377Z9M6 | 117-306 | AGLLALRDKFDLAFANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKEVAVGKTLVSSAMIDRVVNDLGRKLVEVPVGFK… |
| A0A2P2LUF8 | 11-215 | GTTIVTDSVTSDGLTEFIEKKLGGKHHRFRRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARA… |
| A0A4S9W743 | 322-564 | None |
| A0A5B6WJU6 | 128-337 | None |
| A0A843G606 | 5-168 | None |
| A0A7S2CV88 | 5-140 | None |
| A0A3E1K715 | 846-1041 | None |
| A0A7C4NMK7 | 1-153 | None |
| A0A1V2LGQ6 | 323-557 | None |
| A0A1V2LFI7 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.