DPCstruct | MC11088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 226 ± 35 aa |
| Standard deviation of domain lengths | 35.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2LTR4 | 6-215 | RESLDNCKSTLATCQTELEVAKSDIQKWHFAFENESFIPTGASPEPKLVISYLQTLRSSEESLKEQLEKAKKKEAAFIVTFAKREQE… |
| A0A328D5I0 | 61-312 | ILSLRESLKNCEETLATCQSELEAAKSELQKWHSSFLREPFIASGSTPEPRIVVNYVHNLRSSEELLQEQLEKAKKKEAAFIVNIAK… |
| T1FXV2 | 1-243 | None |
| I0YKS0 | 300-499 | None |
| A0A7R8CQ79 | 17-175 | None |
| A0A816UGH4 | 49-323 | None |
| A0A834Z5A1 | 158-362 | None |
| A0A6P5NFR7 | 113-339 | None |
| A0A176VE73 | 74-344 | None |
| V4TNA7 | 1-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.