DPCstruct | MC11087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 29.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 98.14 |
| Assigned Pfam label(s) | CL0031- PF03896- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8MU93 | 22-220 | SQTSTCMQKFRLYETRSNFYMIGRDKSRTYWRVLKIDRLDPSELNIREDSTTYTESECSELLRRIHEGNISTGGLRFVTICYGIVGF… |
| A0A2P2LRW7 | 6-207 | VGGPRNTSIVVATLDTGEVYIIASLSSGTDTQLIYIDPTTGALRYSGKWGVDVFKSEAEALDYITNGSRWLCKSTTYARAILGYAAL… |
| A0A5C3MA56 | 19-196 | None |
| A0A7S3G7V3 | 14-131 | None |
| A0A3F2RGG4 | 169-387 | None |
| A0A2G3D777 | 3-146 | None |
| A0A669F624 | 3-126 | None |
| A0A498N9X9 | 499-652 | None |
| R0M9H8 | 3-116 | None |
| Q6C7E8 | 2-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.