DPCstruct | MC11086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2LRF1 | 1-122 | METIMILVLEESEDISPELLSPLLDSVKKGNEGVVPVAHKLGEKVLESCASKEVVPVSRKLGKKVLESCASKVKPYLVHAVKSLGLS… |
| A0A1D6J9K4 | 181-282 | EQVTHCMEIIMMFVIQESDDVHAELASCLLQNLTREAQETLPASFGLAERVLGLCRDKLKPVLHELLKGTPLDEYSNVVTTLFQDAG… |
| A0A6J1H7Z7 | 2-108 | None |
| A0A830DJ77 | 2-103 | None |
| A0A6A2WE19 | 175-277 | None |
| A0A438F2E3 | 120-222 | None |
| A0A2K3P6T8 | 16-134 | None |
| A0A446MH84 | 167-271 | None |
| A0A2N9IHZ4 | 58-151 | None |
| A0A565CAY8 | 153-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.