DPCstruct | MC11085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 55.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0220- PF02365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8ZZI5 | 159-270 | AGRPYGLSETEIKDLWVQADMDGNGVVDYNEFQQQIWNLTKSEESKHGGENSSNEIRNTVQTIGFSVRNAVLFPTEVEKGKWPESYS… |
| A0A2P2LNP1 | 1-123 | MQKIDSPDSHVMQVNLISFPRGLGFQETRDLWTQADVDGNGIVDYEEFKRIWDSAWTGQTEENCAVRMEDFEQETKEGAIGLTVKNA… |
| A0A5N6RI92 | 721-832 | None |
| A0A6D2K836 | 221-339 | None |
| A0A835UBS7 | 128-230 | None |
| A0A1R3IIB2 | 354-455 | None |
| A0A2K3N2M2 | 39-144 | None |
| A0A6A2YZU5 | 178-287 | None |
| A0A834U1Z0 | 476-585 | None |
| A0A834YTR4 | 675-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.