DPCstruct | MC11084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2LHW9 | 3-69 | HLEDTVRSSCRKVYSHAHDFNINSISNNSDGETFISADDLRINLWNLETSGQCFNIIDMKPSNMEDL |
| A0A0D2UQ20 | 139-196 | RRVYAHAHDYHINSISNNSDGETFISADDLRINLWNLEISNQSFNIVDVKPANMEDLT |
| A0A7J0FYX1 | 238-305 | None |
| A0A183WAE3 | 114-177 | None |
| A0A5J4NA74 | 80-141 | None |
| A0A4S4F247 | 346-414 | None |
| A0A1W0XEM3 | 181-242 | None |
| A0A251SHL1 | 169-244 | None |
| A0A4T0GC78 | 509-568 | None |
| A0A7S3ZP40 | 63-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.