DPCstruct | MC11082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0RGB1 | 39-184 | SPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGE… |
| A0A2P2LEP0 | 3-149 | SPDGFLPFISAQLHYLLNHHRDSIKVEQAWSGSRYNPGSFDRFTLLIPYCLDYIKWDIIYNAEFPLAPPDVIFGPEDEDFHPFHMVD… |
| A0A1X7U399 | 1-144 | None |
| A0A653CP54 | 3-144 | None |
| E9IG95 | 16-134 | None |
| A0A446XPM1 | 9-126 | None |
| A0A7J0F3M8 | 1-147 | None |
| A0A482VJQ7 | 15-144 | None |
| A0A438E4A7 | 2-129 | None |
| A0A2K6EY05 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.