DPCstruct | MC11081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 196 ± 37 aa |
| Standard deviation of domain lengths | 36.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF10151- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P5YXY3 | 223-395 | NEPVRHGVRLLPHCFFEMLVRLTFPAPSARVESTQRFEAIYPLLKEVALAPDISANALKQIFTFSLKLAGGQGNPALANEATAIAIS… |
| A0A2P2LD17 | 2-209 | PPSSLEILMHITYPASSARLKATERFEAIYPTLKEVALAGATGSKAMKQVAQQILTFAVQAAGEDIPKLSREAASISIWCLTQNADC… |
| A0A1D1YG24 | 4-210 | None |
| A0A0D3DQJ0 | 13-146 | None |
| A0A1D6FDT4 | 74-316 | None |
| A0A1J3JF76 | 7-177 | None |
| V5GMJ4 | 52-291 | None |
| D7MKF1 | 134-336 | None |
| A0A6A3CU84 | 57-210 | None |
| A0A0D3CZN8 | 175-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.