DPCstruct | MC1108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 300 ± 54 aa |
| Standard deviation of domain lengths | 54.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1T5S8 | 3-256 | SYRGNCHCGSFRFALDAAPITKATECSCSLCYQKGYLWNEVPEDSKFEVTRDDGKLDTYSSSAMEHKFCKACGTGVFGTHKSGPLQG… |
| A0A369H7M6 | 4-343 | AMEATKTLEAECFCGKVHLAFDVPISRLPLRVYLCHCSKCRYGTGSLCIFHTIITREGPPPRFLGGSSEANLTSYLAPGAKYTYDFC… |
| A0A179IV85 | 1-394 | None |
| A0A1V6SD86 | 1-228 | None |
| A0A1B8F5C9 | 3-289 | None |
| A0A2K1QL50 | 32-426 | None |
| A0A2N7R5Y8 | 13-268 | None |
| A0A812NBN9 | 6-260 | None |
| A0A535A059 | 72-361 | None |
| A0A4Q2DRG3 | 49-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.