DPCstruct | MC11078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 125 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 62.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553MPN1 | 105-228 | FVLFVCLFFTAVQSITCEDNRIDARKKHENDAAHHGHAMATGVWSQEKPKRLFARTRYMSQQRHHLLRPKPKPEAISPVQTPVRRCA… |
| A0A667YMF6 | 1-114 | MWKIPGKHLLCICLLVIPLSWAEDAREEKNDNDSAWSQAKHKRLFARRRIPAPQGSQIPKVKPEAMTPARRCGRLMENCSSHVPCCD… |
| A0A4Z2HW24 | 39-157 | None |
| A0A3Q2XWU9 | 4-132 | None |
| A0A3Q2XXU7 | 62-188 | None |
| M3Z295 | 1-132 | None |
| A0A6P3VTU8 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.