DPCstruct | MC11075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124HVF1 | 1-144 | MSVRDWRYCGKCHVMFYDGNPEKGACPTGGGHEAVGYMFVLPNDVPGTPTAQTDWRRCGRCAVMFYDGYPAKGVCPGGGGHVASGKH… |
| C5BZA1 | 2-143 | PTQRDWRFCDRCHGMFFDGYDPNGVCPAGGTHHAQGYMFTLPHDEPETPTAQRAWRFCDRCHGMFWDGYEHKGACPAGGGHHAQGLE… |
| K4QUN9 | 195-355 | None |
| A0A5P6P3K8 | 325-473 | None |
| A0A2T0K8F5 | 175-323 | None |
| A0A4R2JKV8 | 45-200 | None |
| A0A1Q4Y3X6 | 633-797 | None |
| A0A433QCP1 | 112-284 | None |
| A0A286G9H3 | 471-615 | None |
| A0A2V5QEN6 | 3-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.