DPCstruct | MC11074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 269 ± 41 aa |
| Standard deviation of domain lengths | 40.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8YQI0 | 5-242 | APANLHLAWLSALDFLRLNATRVWTHLMDSGVGFTLPTAVATLTSNEARARHLAAAERGRLGAAALYHLNEEATAAALATDLAPCDL… |
| A0A124HV73 | 27-301 | DHIARYAVVDLWRHQGRIAYDINPEMAAALYRADLKGKLPGGLFQRLPHISPMVPLPRPWPFRSTNGREGLIRAYFLTGHIGQSFCP… |
| A0A102KXW9 | 4-307 | None |
| A0A7W7HL39 | 152-404 | None |
| A0A1H3HB81 | 2-234 | None |
| M6JFG7 | 3-291 | None |
| A0A3D5W5M5 | 160-426 | None |
| A0A3C1GGS7 | 18-311 | None |
| A0A6I6NK18 | 14-329 | None |
| A0A7D5VNI9 | 24-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.