DPCstruct | MC11070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 47 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 81.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9M6K8 | 736-781 | KVSAATCACITNDGVGINPQQSAGVIFLKHGGELRLIPRDRVGSCL |
| A0A078FP25 | 1-55 | MSRSNILFVPPQTSAIITNDGIGINPQHSAGNVFLKHGSELRLIPRDRVGAAFCY |
| A0A6A6L5P2 | 244-289 | None |
| A3FQF1 | 3-55 | None |
| A0A6A4VHW3 | 199-242 | None |
| A0A835G831 | 120-165 | None |
| A0A7R9MR98 | 20-64 | None |
| A0A164RUJ1 | 275-318 | None |
| A0A819T6P7 | 54-100 | None |
| A0A7R9DCB0 | 167-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.