DPCstruct | MC1107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 199 ± 40 aa |
| Standard deviation of domain lengths | 39.56 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351Z1L7 | 4-224 | KSIAVAFSMYSKIPMPRVEWNEKNLRYALCFFPFVGAVTGALLFCWMFLCQRYAANLLLQTLPLLVIPLLVTGGIHADGFLDTSDAL… |
| A0A542DAU2 | 3-142 | LAPLVGVVVGGVAAAVVALAQLVRPDAELLAAVLGVLVVAGLSGGLHLDGLADFADALGSRRDPETMLRIMKQSDIGPFGVVAIVGV… |
| A0A0Q4B5B0 | 98-334 | None |
| A0A5B8MBZ3 | 56-295 | None |
| A0A1Z3HFR4 | 2-198 | None |
| A0A3D1F9G8 | 2-219 | None |
| A0A7C1HYM1 | 23-178 | None |
| A0A1V1V4S3 | 7-177 | None |
| A0A0D2MT49 | 3-229 | None |
| A0A6N3T6H1 | 3-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.