DPCstruct | MC11067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1E4W9 | 1-94 | MDLSTFLKPLDHTIEKIKLEMEENGFEYLPPKAHPKIGRQKIDGKLVCVCHVDYYVLLRACAKLVEVDTQTMHRCVLSLERRLEWID… |
| A0A078F9Q6 | 7-119 | CEPSMECSPSTPDVDNQEDSGSKERAISRLIADMGENYFVYIPPRVKVKRQGYIQYVRKKDDGALVYAVHADYYILLRVCARVAEID… |
| A0A0R0HBK3 | 108-230 | None |
| A0A811P3Y4 | 156-250 | None |
| A0A811NZP4 | 805-945 | None |
| A0A1E5UW45 | 274-368 | None |
| A0A7N0TMV4 | 194-318 | None |
| A0A843XC18 | 43-161 | None |
| A0A0A9DNX6 | 1-119 | None |
| A0A199UFZ1 | 616-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.