DPCstruct | MC11066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 74 ± 2 aa |
| Standard deviation of domain lengths | 1.89 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 66.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3BZK4 | 2-73 | TAMRLVQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTTKEIVGIVKVCEQTLRKRLTEFGDTPTSQLTI |
| A0A3B5AP46 | 2-73 | TALRLVQRMKRDWMHTGRRPSGLCGAALLVAARLHDFRRTIKEVVSIVKVCETTLRKRLVEFEDTPTSQLTI |
| B8BTG5 | 2-77 | None |
| Q4T2A7 | 2-72 | None |
| A0A556V4Z3 | 11-85 | None |
| A0A6V7W5X2 | 11-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.