DPCstruct | MC11065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 46 ± 2 aa |
| Standard deviation of domain lengths | 1.75 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 74.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673KCM1 | 1-44 | MVRMNVLADALKSINNAEKRGKRQVLLRPCSKVIVRFLTVMMKH |
| A0A078F430 | 1-48 | MVRISVLNDALKSMFNAEKRGKRQVMIRPSSKVIIKFLIVMQKHDELS |
| A0A7J9M0L0 | 1-48 | None |
| R9PCK8 | 1-44 | None |
| A0A7J6V2M8 | 1-45 | None |
| A0A0E0NEV9 | 1-44 | None |
| A0A439DIG5 | 1-47 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.