DPCstruct | MC11064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 192 ± 20 aa |
| Standard deviation of domain lengths | 20.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078F2X3 | 1-182 | MDKSSALEYINQMFPTEASLSGVEPLMQKIHGEIRRVDASILSAVRQQSNSGTKAKEDLADATRAVEELSYKIQEIKSKAEQSEAMV… |
| A0A6A0HB61 | 14-171 | SPDFNAVDYINERFPAEQSLHLLDEVLEEMRVKLSLVENETQQLVRQLAINSQVTSGESEQRVRAITRDIRQLDTGKRNLTTSINTL… |
| A0A5C7HYP8 | 65-273 | None |
| A0A5C6GEK2 | 5-200 | None |
| I3L4P9 | 18-202 | None |
| M1AZ94 | 5-185 | None |
| A0A1R1WYJ8 | 1-237 | None |
| L1JVJ4 | 1-214 | None |
| A0A2B4S5Y3 | 26-211 | None |
| A0A163KSK9 | 347-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.