DPCstruct | MC11062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 2.43 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420I826 | 1-74 | MCILSCKNNHRYRVNDFYPLRDSIFEGVKVKIPYKFKPILTQEYSNRALVSTTYYGHHWVSEQREWVKYPQTDS |
| A0A022WE32 | 172-240 | EPGVLSDKNFHQYREADIYPLRQSICEGVPASIPFNYIGILAAEYGNASLWRITYENHSWNGELREWVP |
| A0A428UQJ2 | 114-182 | None |
| A0A507BKE4 | 194-265 | None |
| A0A151GGI4 | 359-427 | None |
| A0A0F8WHD7 | 68-134 | None |
| A0A0G4LSH3 | 22-89 | None |
| H0ERU9 | 5-76 | None |
| A0A1D2VBI1 | 69-136 | None |
| A0A642UJK8 | 247-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.