DPCstruct | MC11061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 239 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 56.86 |
| Assigned Pfam label(s) | PF08451- CL0408- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9I3V3 | 1-206 | MPKGVLHHDHFDCNEDEDFYREHVMTDPNVYLAADRKSFKIGPAEQALKEGWVSFQQLIDEMPNQRKVVKFVSNLTMLSREELLVVS… |
| A0A420I4J1 | 15-267 | VEVQQGLPGCNEPILRHFLASRNSLIDLEKQRRSDHHFRQTCSLISQESCDIVDRIRDEERKTIWNSVAAKTMGQKSEVAVHPGMIF… |
| A0A6P5VPX3 | 7-243 | None |
| R7UFG3 | 33-286 | None |
| A0A6P4L0E3 | 26-315 | None |
| A0A2P6NPN0 | 2-298 | None |
| A0A1R3S1D3 | 334-613 | None |
| A0A7R8ZDU0 | 6-214 | None |
| B4DHM2 | 4-219 | None |
| A0A7U1E561 | 26-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.