DPCstruct | MC1106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 220 ± 29 aa |
| Standard deviation of domain lengths | 29.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351Q9R0 | 271-503 | YELFEWELFPGVLFFDFADYKIQNQFFTRIAYFVEKAGYKGTLVSDDFVENKHGYNAHDYKADDLANFFSLVEQENFQINSYEEILK… |
| A0A524KE00 | 275-497 | PDTLVFDFIDYDTQDLYLKRLAFFAEKPDFKGRLAPDSRIASLHAWNAHDYPPWTLAAFFELARTTLFPLNQQERELQDLLVRFGIL… |
| W5SV30 | 2-197 | None |
| A0A2N1JG25 | 4-241 | None |
| A0A850RF21 | 44-296 | None |
| A0A507FH21 | 92-334 | None |
| A0A7R9UUT6 | 99-338 | None |
| A0A840A978 | 24-247 | None |
| A0A317XQC0 | 519-815 | None |
| A0A7S0YB42 | 34-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.