DPCstruct | MC11058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2GQR3 | 20-150 | LFVHMPKDLRRQQKITEFIEVLRNKGVDVAEIECMELPLSPTFLSDRIPSLDQTISATLFNLFREKGFVNENGYMKRDGRATHWKDA… |
| A0A1V9FQI8 | 266-407 | PYQFCMAKNDDQPEVGATGNADALTNSQGLNSRGVCSKYFITDRSPVYPERFARLSDISVATSTAIFKELKNNNWLTDKNFMKANSD… |
| K8ECP4 | 200-342 | None |
| A0A3B9ANB7 | 236-369 | None |
| A0A4D8ZXA9 | 195-346 | None |
| A0A7S3BKW0 | 1-138 | None |
| A0A7J7ME78 | 129-264 | None |
| A0A7S0TXN6 | 4-133 | None |
| A0A446PGW5 | 164-314 | None |
| A0A2G3BCL1 | 597-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.