DPCstruct | MC11057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 234 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5I197 | 175-430 | IRKNYFSDERGSKRAVNLLVKKLKGEEFVTEFKMPVFDRVEPNKAVEDISKCKIAIVTSGGIVPKGNPDHIESSSASKYGKYDIEGL… |
| A0A7V0WW54 | 17-253 | YEQLARSYRIRERQRNITWTPFEAKLIDSKIALISVCGAYLKSGKPFTKEPQDSNYSYRAIDINFDRDDLEFFALDWETSELEKDIN… |
| A0A2G4J4E3 | 51-273 | None |
| A0A2E7PG07 | 74-331 | None |
| A0A7Y5G583 | 12-239 | None |
| A0A523DBE1 | 45-291 | None |
| A0A4R2JAT4 | 445-664 | None |
| A0A7C1ESE8 | 23-250 | None |
| A0A7T8VQT1 | 3-245 | None |
| A0A2A3EWD6 | 14-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.