DPCstruct | MC11056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 318 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8ZF04 | 4-301 | GSVVAVLMHICCTMAKLSLSDLKSIQSRGVYSGFGGVVIINPNGPLNLLRGYIYKRLGLMNNMRFFSPGIKVSYELTANEKKDVNGN… |
| I3EKQ8 | 11-299 | NKYVLSTILTKKYIMALLLLIQTAYSHVGMSDAKEIDKMMLGSKNNIAINSNGDLSSIKGYILHKCGYMQNLRYYLSYIIEIEPDYI… |
| A0A086J2V6 | 1-351 | None |
| H8ZBC4 | 34-322 | None |
| I3EPZ9 | 29-362 | None |
| A0A086J5G1 | 14-344 | None |
| A0A086IZB9 | 2-358 | None |
| A0A177ER52 | 19-348 | None |
| A0A177EPT1 | 17-318 | None |
| A0A177EM81 | 27-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.