DPCstruct | MC11055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 158 ± 22 aa |
| Standard deviation of domain lengths | 21.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3EIN4 | 248-381 | YSLYGVNKSTESGYYFIDANGTLKIDRNISSRSNNVYNGVVLKDGDGTVPVVSLGYMGISGWKKKSLNPYGVKTVNREYKHVPSTSI… |
| A0A3L6P1R1 | 197-343 | KIYCFYGVGKPTERGYYYRSPDQPLMTNLNITMDTGFTEGDVDHGVIMGEGDGTVNLLSTGYMCNHGWNMKRYNPAGVKVTVVEMPH… |
| A0A6P5FAQ5 | 516-675 | None |
| A0A7S4V0Q8 | 82-269 | None |
| A0A2I0LDN3 | 235-386 | None |
| A0A7S0YPN9 | 31-176 | None |
| A0A7J0GBF1 | 362-526 | None |
| A0A7S2XUM9 | 579-762 | None |
| A0A7S1FDU4 | 75-228 | None |
| A0A2H9TLX5 | 295-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.