DPCstruct | MC1105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 174 ± 26 aa |
| Standard deviation of domain lengths | 25.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1K8M6 | 2-116 | TFFNEKTNRLYWFDLAGDQWMVEGYFLRWSLALRWMGAGSYYRVTRFSGRWENPEGKTTSVYQIHPEEKLWKFLLKHGEKIPFVDAA… |
| A0A2G6QPI3 | 6-189 | LVALQVLVVLSVFSCALLDKIISGQEESIFALKSQIVSMKFEVSKQGNNEMLVSYAFYNLSGQKLGLSQTVKLRGSELFIDCRVERL… |
| A0A3A4QJ92 | 18-240 | None |
| A0A2M7WLY7 | 53-225 | None |
| A0A3M2AM08 | 41-238 | None |
| A0A7V4P180 | 35-226 | None |
| A0A1W9SQJ3 | 112-305 | None |
| A0A1G3M3Z7 | 3-137 | None |
| A0A5C0B829 | 22-197 | None |
| A0A1W9TES7 | 4-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.